PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010093351.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 339aa    MW: 38393.7 Da    PI: 7.8228
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010093351.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.8e-332073255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWtpeLH++Fv+a+e+LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  XP_010093351.1 20 PRLRWTPELHHCFVHAIERLGGHKKATPKLVLQLMDVKGLTISHVKSHLQMYRS 73
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-311675IPR009057Homeodomain-like
PROSITE profilePS5129410.7311676IPR017930Myb domain
SuperFamilySSF466891.65E-151873IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-232073IPR006447Myb domain, plants
PfamPF002496.7E-92172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MTNSCGRNGA VRQYIRSKVP RLRWTPELHH CFVHAIERLG GHKKATPKLV LQLMDVKGLT  60
ISHVKSHLQM YRSMRGDLGC RQDRDSSQQR KQSFKEHDHQ HSLIDGHDQV NGVGFNRPSS  120
KRIRESDSQL YSSLPSKRAR METRSSNISE CHEQEESRIS SCEKLVSNPY CFDDYLMALA  180
ERNYGIKEQP LLQQQHTQPH QYSTAAAFSL PPQHHLFTNL NPFKYAVQES DFFKVNEPDQ  240
DERHEAKQLH RYEKSTEAET DQDIELAGGC CDLSLSLSLH DHQHNPSSNR SNASSTSEIS  300
VAISSYSLSA AAKYKDCSIS SSTAKHSLNL DLSVALCGN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093351.10.0Putative Myb family transcription factor
TrEMBLW9R1B90.0W9R1B9_9R
STRINGVIT_01s0137g00050.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.11e-32G2-like family protein